Nama – Nama Terpanjang

1. Nama Desa Terpanjang

 

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

Ia adalah sebuah desa di pulau Anglesey di Wales, Britania Raya. Desa ini tercatat dalam Guiness Book of Record sebagai tempat yang namanya terpanjang di Britania.

 

2. Nama Orang Terpanjang

 

Autumn Sullivan Corbett Fitzsimmons Jeffries Hart Burns Johnson Willard Dempsey Tunney Schmeling Sharkey Carnera Baer Braddock Louis Charles Walcott Marciano Patterson Johansson Liston Clay Frazier Foreman Brown

 

27 kata itu adalah nama seorang anak di Inggris. Namanya diambil dari 25 nama petinju top dari seluruh dunia. Sisa 2 adalah nama depan dan nama keluarga. Wuih, pasti papa nya penggemar tinju yah

 

3. Nama Bukit Terpanjang

 

Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu

 

Ia adalah nama sebuah bukit di Porangahau, di selatan Waipukurau di selatan Hawke’s Bay, Selandia Baru. Nama ini biasanya disingkat jadi Taumata. Trus buat apa panjang2 confused

 

4. Nama Domain dan Nama Kota Terpanjang

 

http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk/

 

ia merupakan situs untuk mempromosikan sebuah kota di Anglesey, Gwynedd, Inggris. Nama kotanya sama kayak nama situsnya..

 

5. Nama Album Terpanjang

 

he Who Dwells in the Secret Place of the Most High Shall Abide Under the Shadow of the Almighty

 

Ia adalah nama sebuah album yang dirilis oleh mantan penyanyi Sin Ad O’Connor

 

6. Nama E-Mail Terpanjang

 

yourname@abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijk.com

nama yang sangat panjang untuk sebuah email address rolleyes

cara daftarnya, masuk aja ke web nya di http://www.abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijk.com/

 

7. Nama Tempat Terpanjang

 

Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajthaniburiromudomrajniwes hasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit

nama tempat di Thailand. Ga tau nama tempat apa hehe..

 

8. Nama Perkumpulan Terpanjang (di Indonesia)

 

KNNYPNITDI

Ikatan Komikus Nggak Nyambung Yang Punya Nama Ikatan Terpanjang Di Indonesia.

Comment

Leave a Reply

Your email address will not be published. Required fields are marked *

2 comments

  1. Ingat Sumanto Kanibal dari Purbalingga? dia juga memiliki nama yang panjang yaitu :
    Raden Mas Ngabehi Sumanto Hadiprayitno Sastrowardoyo Suryopranoto Hono
    Coroko Dhotosowolo Podo Joyonyo Sosrohadimenggolo Jalmowono bin Tasrep Supeno bin Marwoto Susiswo

News Feed